# STOCKHOLM 1.0 #=GF ID 3.30.60.30/FF/000155 #=GF DE Reversion-inducing cysteine-rich protein with Kazal motifs #=GF AC 3.30.60.30/FF/000155 #=GF TP FunFam #=GF DR CATH: v4.3 #=GF DR DOPS: 0.000 #=GS B3RQZ7/607-654 AC B3RQZ7 #=GS B3RQZ7/607-654 OS Trichoplax adhaerens #=GS B3RQZ7/607-654 DE Uncharacterized protein #=GS B3RQZ7/607-654 DR ORG; Eukaryota; Metazoa; Placozoa; Trichoplacidae; Trichoplax; Trichoplax adhaerens; #=GS A0A369S8G9/604-651 AC A0A369S8G9 #=GS A0A369S8G9/604-651 OS Trichoplax sp. H2 #=GS A0A369S8G9/604-651 DE Reversion-inducing cysteine-rich protein with Kazal motifs #=GS A0A369S8G9/604-651 DR ORG; Eukaryota; Metazoa; Placozoa; Trichoplacidae; Trichoplax; Trichoplax sp. H2; #=GF SQ 2 B3RQZ7/607-654 LPCDCQLKYEPVCGINGQTFGNPCLAQCAGLGEDEYRTGQCIEIEPCQ A0A369S8G9/604-651 LPCDCQLKYEPVCGINGQTFGNPCLAQCAGLGEDEYRTGQCIEIEPCQ #=GC scorecons 000000000000000000000000000000000000000000000000 #=GC scorecons_70 ________________________________________________ #=GC scorecons_80 ________________________________________________ #=GC scorecons_90 ________________________________________________ //