# STOCKHOLM 1.0 #=GF ID 3.10.20.90/FF/000887 #=GF DE FERM, RhoGEF and pleckstrin domain protein 2 #=GF AC 3.10.20.90/FF/000887 #=GF TP FunFam #=GF DR CATH: v4.3 #=GF DR DOPS: 0.000 #=GS X1WFV0/48-103 AC X1WFV0 #=GS X1WFV0/48-103 OS Danio rerio #=GS X1WFV0/48-103 DE FERM, RhoGEF and pleckstrin domain protein 2 #=GS X1WFV0/48-103 DR ORG; Eukaryota; Metazoa; Chordata; Craniata; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Otomorpha; Ostariophysi; Cypriniphysae; Cypriniformes; Cyprinoidei; Cyprinidae; Danio; Danio rerio; #=GF SQ 1 X1WFV0/48-103 NKGLQIRVQGLDEAQEFYELESKADGQLLLSDVFRRINLIESDYFGSGDRSQTGNV #=GC scorecons 00000000000000000000000000000000000000000000000000000000 #=GC scorecons_70 ________________________________________________________ #=GC scorecons_80 ________________________________________________________ #=GC scorecons_90 ________________________________________________________ //