# STOCKHOLM 1.0 #=GF ID 2.30.42.10/FF/000569 #=GF DE PDZ and LIM domain 1 #=GF AC 2.30.42.10/FF/000569 #=GF TP FunFam #=GF DR CATH: v4.3 #=GF DR DOPS: 0.000 #=GS F6WFT9/1-55 AC F6WFT9 #=GS F6WFT9/1-55 OS Ornithorhynchus anatinus #=GS F6WFT9/1-55 DE PDZ and LIM domain 1 #=GS F6WFT9/1-55 DR ORG; Eukaryota; Metazoa; Chordata; Craniata; Sarcopterygii; Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus; Ornithorhynchus anatinus; #=GF SQ 1 F6WFT9/1-55 MNTERIVIQGPGPWGFRLVGGKDFEQPLTISRVHPAVKSAISLKCCGWGITVLQG #=GC scorecons 0000000000000000000000000000000000000000000000000000000 #=GC scorecons_70 _______________________________________________________ #=GC scorecons_80 _______________________________________________________ #=GC scorecons_90 _______________________________________________________ //