# STOCKHOLM 1.0
#=GF ID 1.20.1270.220/FF/000003
#=GF DE Global transcription factor group E8
#=GF AC 1.20.1270.220/FF/000003
#=GF TP FunFam
#=GF DR CATH: v4.3
#=GF DR DOPS: 76.323
#=GS Q9FGW9/308-386      AC Q9FGW9
#=GS Q9FGW9/308-386      OS Arabidopsis thaliana
#=GS Q9FGW9/308-386      DE Transcription factor GTE10
#=GS Q9FGW9/308-386      DR ORG; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis thaliana; 
#=GS Q9FGW9/308-386      DR GO; GO:0005515; GO:0005634; GO:0009409; GO:0009651; GO:0009737; GO:0045892; GO:0051365; 
#=GS Q93ZB7/274-351      AC Q93ZB7
#=GS Q93ZB7/274-351      OS Arabidopsis thaliana
#=GS Q93ZB7/274-351      DE Transcription factor GTE11
#=GS Q93ZB7/274-351      DR ORG; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis thaliana; 
#=GS Q93ZB7/274-351      DR GO; GO:0005515; GO:0009737; GO:0045893; 
#=GS F4K6Q7/284-360      AC F4K6Q7
#=GS F4K6Q7/284-360      OS Arabidopsis thaliana
#=GS F4K6Q7/284-360      DE Bromodomain and extraterminal domain protein 9
#=GS F4K6Q7/284-360      DR ORG; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis thaliana; 
#=GS F4K6Q7/284-360      DR GO; GO:0005515; GO:0009737; 
#=GS Q9LK27/324-401      AC Q9LK27
#=GS Q9LK27/324-401      OS Arabidopsis thaliana
#=GS Q9LK27/324-401      DE Transcription factor GTE8
#=GS Q9LK27/324-401      DR ORG; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis thaliana; 
#=GS Q9LK27/324-401      DR GO; GO:0009507; 
#=GS Q93YS6/284-360      AC Q93YS6
#=GS Q93YS6/284-360      OS Arabidopsis thaliana
#=GS Q93YS6/284-360      DE Transcription factor GTE9
#=GS Q93YS6/284-360      DR ORG; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis thaliana; 
#=GS Q93YS6/284-360      DR GO; GO:0005515; 
#=GS A0A178UIE5/308-386  AC A0A178UIE5
#=GS A0A178UIE5/308-386  OS Arabidopsis thaliana
#=GS A0A178UIE5/308-386  DE NPX1
#=GS A0A178UIE5/308-386  DR ORG; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis thaliana; 
#=GS A0A1I9LS78/324-401  AC A0A1I9LS78
#=GS A0A1I9LS78/324-401  OS Arabidopsis thaliana
#=GS A0A1I9LS78/324-401  DE Global transcription factor group E8
#=GS A0A1I9LS78/324-401  DR ORG; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis thaliana; 
#=GS F4JEZ0/275-352      AC F4JEZ0
#=GS F4JEZ0/275-352      OS Arabidopsis thaliana
#=GS F4JEZ0/275-352      DE Global transcription factor group E8
#=GS F4JEZ0/275-352      DR ORG; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis thaliana; 
#=GS A0A1I9LS77/324-401  AC A0A1I9LS77
#=GS A0A1I9LS77/324-401  OS Arabidopsis thaliana
#=GS A0A1I9LS77/324-401  DE Global transcription factor group E8
#=GS A0A1I9LS77/324-401  DR ORG; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis thaliana; 
#=GS A0A1I9LQQ3/274-351  AC A0A1I9LQQ3
#=GS A0A1I9LQQ3/274-351  OS Arabidopsis thaliana
#=GS A0A1I9LQQ3/274-351  DE Bromodomain and extraterminal domain protein 10
#=GS A0A1I9LQQ3/274-351  DR ORG; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis thaliana; 
#=GS R0H2Q7/324-401      AC R0H2Q7
#=GS R0H2Q7/324-401      OS Capsella rubella
#=GS R0H2Q7/324-401      DE Uncharacterized protein
#=GS R0H2Q7/324-401      DR ORG; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Brassicales; Brassicaceae; Camelineae; Capsella; Capsella rubella; 
#=GS D7LLY7/324-401      AC D7LLY7
#=GS D7LLY7/324-401      OS Arabidopsis lyrata subsp. lyrata
#=GS D7LLY7/324-401      DE Uncharacterized protein
#=GS D7LLY7/324-401      DR ORG; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis lyrata; Arabidopsis lyrata subsp. lyrata; 
#=GS D7L9L5/271-348      AC D7L9L5
#=GS D7L9L5/271-348      OS Arabidopsis lyrata subsp. lyrata
#=GS D7L9L5/271-348      DE ATBET10
#=GS D7L9L5/271-348      DR ORG; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis lyrata; Arabidopsis lyrata subsp. lyrata; 
#=GS D7M621/283-360      AC D7M621
#=GS D7M621/283-360      OS Arabidopsis lyrata subsp. lyrata
#=GS D7M621/283-360      DE ATBET9
#=GS D7M621/283-360      DR ORG; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis lyrata; Arabidopsis lyrata subsp. lyrata; 
#=GF SQ 14
Q9FGW9/308-386              -EPAKLVMTDGEKKKLGQDLMALEEDFPQKIADLLREQSGSDGQSGEGEIEIDIEALSDEILFMVRKLLDDYLREKKKSM
Q93ZB7/274-351              -EPAKRVMTDEDRVKLGRDLGSL-TEFPVQIINFLRDHSSKEERSGDDEIEIDINDLSHDALFQLRDLFDEFLRENQKKD
F4K6Q7/284-360              -DPAKRVMTDEDRLKLGKDLESL-TEFPAQLINFLRDHNSNEGGIGDDEIEIDINDLSDHALFQLRDLLDEHLREIQNK-
Q9LK27/324-401              -EPVKPLMTEVERHRLGRQLESLLDELPAHIIDFLKKHNSNGGEIAEDEIEIDIDVLSDEVLVTLRNLLDEYIQNKEAK-
Q93YS6/284-360              -DPAKRVMTDEDRLKLGKDLESL-TEFPAQLINFLRDHNSNEGGIGDDEIEIDINDLSDHALFQLRDLLDEHLREIQNK-
A0A178UIE5/308-386          -EPAKLVMTDGEKKKLGQDLMALEEDFPQKIADLLREQSGSDGQSGEGEIEIDIEALSDEILFMVRKLLDDYLREKKKSM
A0A1I9LS78/324-401          -EPVKPLMTEVERHRLGRQLESLLDELPAHIIDFLKKHNSNGGEIAEDEIEIDIDVLSDEVLVTLRNLLDEYIQNKEAK-
F4JEZ0/275-352              -EPVKPLMTEVERHRLGRQLESLLDELPAHIIDFLKKHNSNGGEIAEDEIEIDIDVLSDEVLVTLRNLLDEYIQNKEAK-
A0A1I9LS77/324-401          -EPVKPLMTEVERHRLGRQLESLLDELPAHIIDFLKKHNSNGGEIAEDEIEIDIDVLSDEVLVTLRNLLDEYIQNKEAK-
A0A1I9LQQ3/274-351          -EPAKRVMTDEDRVKLGRDLGSL-TEFPVQIINFLRDHSSKEERSGDDEIEIDINDLSHDALFQLRDLFDEFLRENQKKD
R0H2Q7/324-401              -ESVKPLMTAEERHRLGTQLESLLDELPAHIIDFLKKHSSNGGEIAEDEIEIDIDVLSDEVLVTLRNLLDEYIQNKEAK-
D7LLY7/324-401              -EPVKPLMTAEERHRLGRQLESLLDELPAHIIDFLKKHSSNGGEIAEDEIEIDIDVLSDEVLVTLRNLLDEYIQNKETK-
D7L9L5/271-348              -EPAKRVMTDEDRVKLGRDLGSL-TEFPVQIINFLRDHSSKEGRSGDDEIEIDINDLSHDALFQLRDLFDEFLRENQRKD
D7M621/283-360              SEPVKRVMTDEDRLKLGKDLESL-TEFPAQLINFLRDHNSNEGGIGDDEIEIDINDLSHHALFQLRDLLDEHLRESQNK-
#=GC scorecons              08869469964773799559479147695576679757675574567799999954996559547959797666645460
#=GC scorecons_70           _**_*_***__**_***__*_**__***__******_*_*__*___********__***__*__**_*******____*_
#=GC scorecons_80           _**_*__**___*__**__*__*__*_*__*__**__*____*_____******__**___*__**_****_________
#=GC scorecons_90           __*_*__**______**__*__*____*______*_____________******__**___*___*_*_*__________
//