# STOCKHOLM 1.0 #=GF ID 3.30.1680.10/FF/000060 #=GF DE Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6B #=GF AC 3.30.1680.10/FF/000060 #=GF TP FunFam #=GF DR CATH: v4.3 #=GF DR DOPS: 0.000 #=GS F6Q6S9/513-548 AC F6Q6S9 #=GS F6Q6S9/513-548 OS Xenopus tropicalis #=GS F6Q6S9/513-548 DE Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6B #=GS F6Q6S9/513-548 DR ORG; Eukaryota; Metazoa; Chordata; Craniata; Sarcopterygii; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana; Xenopus tropicalis; #=GF SQ 1 F6Q6S9/513-548 CQRHDGCIRSCLGTRDPYCAWDPANNLCTFTPQGIR #=GC scorecons 000000000000000000000000000000000000 #=GC scorecons_70 ____________________________________ #=GC scorecons_80 ____________________________________ #=GC scorecons_90 ____________________________________ //