# STOCKHOLM 1.0 #=GF ID 2.60.40.60/FF/001068 #=GF DE Novel protein similar to human procadherin 15 (PCDH15) #=GF AC 2.60.40.60/FF/001068 #=GF TP FunFam #=GF DR CATH: v4.3 #=GF DR DOPS: 0.000 #=GS Q8AW61/567-623 AC Q8AW61 #=GS Q8AW61/567-623 OS Danio rerio #=GS Q8AW61/567-623 DE Novel protein similar to human procadherin 15 (PCDH15) #=GS Q8AW61/567-623 DR ORG; Eukaryota; Metazoa; Chordata; Craniata; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Otomorpha; Ostariophysi; Cypriniphysae; Cypriniformes; Cyprinoidei; Cyprinidae; Danio; Danio rerio; #=GS Q8AW61/567-623 DR GO; GO:0006897; GO:0007423; GO:0016021; GO:0035315; GO:0050910; GO:0050974; GO:0060271; #=GF SQ 1 Q8AW61/567-623 NQSPPRFPLQTYNLEISEAMRIGAILLNLQATDRELDPITYRIETGDPQEVFNLSRT #=GC scorecons 000000000000000000000000000000000000000000000000000000000 #=GC scorecons_70 _________________________________________________________ #=GC scorecons_80 _________________________________________________________ #=GC scorecons_90 _________________________________________________________ //