# STOCKHOLM 1.0 #=GF ID 2.20.70.10/FF/000253 #=GF DE Membrane associated guanylate kinase, WW and PDZ domain containing 3 #=GF AC 2.20.70.10/FF/000253 #=GF TP FunFam #=GF DR CATH: v4.3 #=GF DR DOPS: 0.000 #=GS F7AV49/341-388 AC F7AV49 #=GS F7AV49/341-388 OS Monodelphis domestica #=GS F7AV49/341-388 DE Membrane associated guanylate kinase, WW and PDZ domain containing 3 #=GS F7AV49/341-388 DR ORG; Eukaryota; Metazoa; Chordata; Craniata; Sarcopterygii; Mammalia; Didelphimorphia; Didelphidae; Didelphinae; Monodelphis; Monodelphis domestica; #=GF SQ 1 F7AV49/341-388 LPYGWEKIEDPQYGTYYVEKTLYTETDTLWYNRIHINQKTQFENPVVE #=GC scorecons 000000000000000000000000000000000000000000000000 #=GC scorecons_70 ________________________________________________ #=GC scorecons_80 ________________________________________________ #=GC scorecons_90 ________________________________________________ //