# STOCKHOLM 1.0 #=GF ID 1.25.40.30/FF/000002 #=GF DE Clathrin and VPS domain-containing protein #=GF AC 1.25.40.30/FF/000002 #=GF TP FunFam #=GF DR CATH: v4.3 #=GF DR DOPS: 0.000 #=GS A2GLT4/1-53 AC A2GLT4 #=GS A2GLT4/1-53 OS Trichomonas vaginalis #=GS A2GLT4/1-53 DE Clathrin and VPS domain-containing protein #=GS A2GLT4/1-53 DR ORG; Eukaryota; Trichomonadida; Trichomonadidae; Trichomonas; Trichomonas vaginalis; #=GS A2GL34/1-53 AC A2GL34 #=GS A2GL34/1-53 OS Trichomonas vaginalis #=GS A2GL34/1-53 DE Clathrin and VPS domain-containing protein #=GS A2GL34/1-53 DR ORG; Eukaryota; Trichomonadida; Trichomonadidae; Trichomonas; Trichomonas vaginalis; #=GF SQ 2 A2GLT4/1-53 MGKANLIQNWIKNDSLTPSENLGDVCKQADPITAAAIYIRAGAHAKVCATFAE A2GL34/1-53 MGKANLIQNWIKNDSLTPSENLGDVCKQADPITAAAIYIRAGAHAKVCATFAE #=GC scorecons 00000000000000000000000000000000000000000000000000000 #=GC scorecons_70 _____________________________________________________ #=GC scorecons_80 _____________________________________________________ #=GC scorecons_90 _____________________________________________________ //