# STOCKHOLM 1.0 #=GF ID 1.25.40.20/FF/001718 #=GF DE Inhibitor of Bruton tyrosine kinase #=GF AC 1.25.40.20/FF/001718 #=GF TP FunFam #=GF DR CATH: v4.3 #=GF DR DOPS: 0.000 #=GS Q6ZPR6/89-131 AC Q6ZPR6 #=GS Q6ZPR6/89-131 OS Mus musculus #=GS Q6ZPR6/89-131 DE Inhibitor of Bruton tyrosine kinase #=GS Q6ZPR6/89-131 DR ORG; Eukaryota; Metazoa; Chordata; Craniata; Sarcopterygii; Mammalia; Euarchontoglires; Rodentia; Myomorpha; Muridae; Murinae; Mus; Mus; Mus musculus; #=GS Q6ZPR6/89-131 DR GO; GO:0001933; GO:0005654; GO:0005737; GO:0019901; GO:0030292; GO:0051209; #=GF SQ 1 Q6ZPR6/89-131 ALHRSVFYGHIDCVWSLLKHGVSLYMQDKEGLSPLDLLMKDRP #=GC scorecons 0000000000000000000000000000000000000000000 #=GC scorecons_70 ___________________________________________ #=GC scorecons_80 ___________________________________________ #=GC scorecons_90 ___________________________________________ //