# STOCKHOLM 1.0 #=GF ID 1.25.40.20/FF/001497 #=GF DE Predicted protein #=GF AC 1.25.40.20/FF/001497 #=GF TP FunFam #=GF DR CATH: v4.3 #=GF DR DOPS: 0.000 #=GS A8IQA5/176-242 AC A8IQA5 #=GS A8IQA5/176-242 OS Chlamydomonas reinhardtii #=GS A8IQA5/176-242 DE Predicted protein #=GS A8IQA5/176-242 DR ORG; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas; Chlamydomonas reinhardtii; #=GF SQ 1 A8IQA5/176-242 KHTHNRYGDEEAVEDFIAIGKDLNEPDAQGRTALHYSVAYDHPVIAKMLVDEGANLEARDSLNNTPL #=GC scorecons 0000000000000000000000000000000000000000000000000000000000000000000 #=GC scorecons_70 ___________________________________________________________________ #=GC scorecons_80 ___________________________________________________________________ #=GC scorecons_90 ___________________________________________________________________ //