# STOCKHOLM 1.0 #=GF ID 1.10.246.20/FF/000013 #=GF DE Mediator of RNA polymerase II transcription subunit 15 #=GF AC 1.10.246.20/FF/000013 #=GF TP FunFam #=GF DR CATH: v4.3 #=GF DR DOPS: 0.000 #=GS W4YN44/1-55 AC W4YN44 #=GS W4YN44/1-55 OS Strongylocentrotus purpuratus #=GS W4YN44/1-55 DE Mediator of RNA polymerase II transcription subunit 15 #=GS W4YN44/1-55 DR ORG; Eukaryota; Metazoa; Echinodermata; Echinozoa; Echinoidea; Euechinoidea; Echinacea; Echinoida; Strongylocentrotidae; Strongylocentrotus; Strongylocentrotus purpuratus; #=GF SQ 1 W4YN44/1-55 MCNDALRDACNPIEKSGSELEEHIFNRARDRDSYLSLVARLILHMRDSNAAKEKG #=GC scorecons 0000000000000000000000000000000000000000000000000000000 #=GC scorecons_70 _______________________________________________________ #=GC scorecons_80 _______________________________________________________ #=GC scorecons_90 _______________________________________________________ //