# STOCKHOLM 1.0
#=GF ID 1.10.10.10/FF/45416
#=GF DE Transcriptional regulatory protein CutR
#=GF AC 1.10.10.10/FF/45416
#=GF TP FunFam
#=GF DR CATH: 4.2
#=GF DR DOPS: 17.533
#=GS P0A4I1/124-217      AC P0A4I1
#=GS P0A4I1/124-217      OS Streptomyces coelicolor A3(2)
#=GS P0A4I1/124-217      DE Transcriptional regulatory protein CutR
#=GS P0A4I1/124-217      DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS P0A4I1/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces coelicolor; 
#=GS A0A0X3T389/122-217  AC A0A0X3T389
#=GS A0A0X3T389/122-217  OS Streptomyces albus subsp. albus
#=GS A0A0X3T389/122-217  DE Two-component system response regulator
#=GS A0A0X3T389/122-217  DR GENE3D; 007cfb56d37c421f0280e312fb2289d4/122-217; 
#=GS A0A0X3T389/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus group; Streptomyces albus; Streptomyces albus subsp. albus; 
#=GS A0A1C5FV05/122-217  AC A0A1C5FV05
#=GS A0A1C5FV05/122-217  OS Streptomyces sp. MnatMP-M27
#=GS A0A1C5FV05/122-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C5FV05/122-217  DR GENE3D; b13a17a531a747afa94e50b3563fefed/122-217; 
#=GS A0A1C5FV05/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. MnatMP-M27; 
#=GS G2P2D5/122-217      AC G2P2D5
#=GS G2P2D5/122-217      OS Streptomyces violaceusniger Tu 4113
#=GS G2P2D5/122-217      DE Two component transcriptional regulator, winged helix family
#=GS G2P2D5/122-217      DR GENE3D; b13a17a531a747afa94e50b3563fefed/122-217; 
#=GS G2P2D5/122-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces violaceusniger; 
#=GS A0A0X3XG62/122-217  AC A0A0X3XG62
#=GS A0A0X3XG62/122-217  OS Streptomyces violaceusniger
#=GS A0A0X3XG62/122-217  DE Two-component system response regulator
#=GS A0A0X3XG62/122-217  DR GENE3D; b13a17a531a747afa94e50b3563fefed/122-217; 
#=GS A0A0X3XG62/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces violaceusniger; 
#=GS A0A014MN82/122-217  AC A0A014MN82
#=GS A0A014MN82/122-217  OS Streptomyces sp. PRh5
#=GS A0A014MN82/122-217  DE Transcriptional regulator
#=GS A0A014MN82/122-217  DR GENE3D; b13a17a531a747afa94e50b3563fefed/122-217; 
#=GS A0A014MN82/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PRh5; 
#=GS A0A0F4KCM1/122-217  AC A0A0F4KCM1
#=GS A0A0F4KCM1/122-217  OS Streptomyces sp. NRRL B-1568
#=GS A0A0F4KCM1/122-217  DE Transcriptional regulator
#=GS A0A0F4KCM1/122-217  DR GENE3D; b4a3957ba0547d7473d1019ad0fcf4fd/122-217; 
#=GS A0A0F4KCM1/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL B-1568; 
#=GS D9W9Q4/122-217      AC D9W9Q4
#=GS D9W9Q4/122-217      OS Streptomyces himastatinicus ATCC 53653
#=GS D9W9Q4/122-217      DE Transcriptional regulatory protein CutR
#=GS D9W9Q4/122-217      DR GENE3D; bb9eb9ddcc3b755d25adad635fb9558b/122-217; 
#=GS D9W9Q4/122-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces himastatinicus; 
#=GS A0A0L8QT93/122-217  AC A0A0L8QT93
#=GS A0A0L8QT93/122-217  OS Streptomyces varsoviensis
#=GS A0A0L8QT93/122-217  DE Transcriptional regulator
#=GS A0A0L8QT93/122-217  DR GENE3D; db72c4bdced5643a497952668b2be59e/122-217; 
#=GS A0A0L8QT93/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces varsoviensis; 
#=GS D7C8K0/122-217      AC D7C8K0
#=GS D7C8K0/122-217      OS Streptomyces bingchenggensis BCW-1
#=GS D7C8K0/122-217      DE Two-component regulator CutR
#=GS D7C8K0/122-217      DR GENE3D; df9575ed1c29c40a5220d7240dc56c34/122-217; 
#=GS D7C8K0/122-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces bingchenggensis; 
#=GS V6KFA8/124-217      AC V6KFA8
#=GS V6KFA8/124-217      OS Streptomyces niveus NCIMB 11891
#=GS V6KFA8/124-217      DE Transcriptional regulator
#=GS V6KFA8/124-217      DR GENE3D; 97d4ba9f28a89e9790b3c543ef6ce48f/124-217; 
#=GS V6KFA8/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces niveus; 
#=GS B1VXN3/122-217      AC B1VXN3
#=GS B1VXN3/122-217      OS Streptomyces griseus subsp. griseus NBRC 13350
#=GS B1VXN3/122-217      DE Putative two-component system response regulator
#=GS B1VXN3/122-217      DR GENE3D; 2502f2a516f2ccd79e94ca1bd3113948/122-217; 
#=GS B1VXN3/122-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseus group; Streptomyces griseus; Streptomyces griseus subsp. griseus; 
#=GS G0PYW2/122-217      AC G0PYW2
#=GS G0PYW2/122-217      OS Streptomyces sp. ACT-1
#=GS G0PYW2/122-217      DE Two component transcriptional regulator, winged helix family
#=GS G0PYW2/122-217      DR GENE3D; 2502f2a516f2ccd79e94ca1bd3113948/122-217; 
#=GS G0PYW2/122-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. ACT-1; 
#=GS A0A1C4RS67/122-217  AC A0A1C4RS67
#=GS A0A1C4RS67/122-217  OS Streptomyces sp. OspMP-M43
#=GS A0A1C4RS67/122-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C4RS67/122-217  DR GENE3D; 2502f2a516f2ccd79e94ca1bd3113948/122-217; 
#=GS A0A1C4RS67/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. OspMP-M43; 
#=GS A0A0Q8EMD3/122-217  AC A0A0Q8EMD3
#=GS A0A0Q8EMD3/122-217  OS Streptomyces sp. Root63
#=GS A0A0Q8EMD3/122-217  DE Two-component system response regulator
#=GS A0A0Q8EMD3/122-217  DR GENE3D; 2502f2a516f2ccd79e94ca1bd3113948/122-217; 
#=GS A0A0Q8EMD3/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Root63; 
#=GS A0A1C4RZK7/122-217  AC A0A1C4RZK7
#=GS A0A1C4RZK7/122-217  OS Streptomyces sp. DvalAA-19
#=GS A0A1C4RZK7/122-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C4RZK7/122-217  DR GENE3D; 2502f2a516f2ccd79e94ca1bd3113948/122-217; 
#=GS A0A1C4RZK7/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. DvalAA-19; 
#=GS A0A0L0JXZ0/122-217  AC A0A0L0JXZ0
#=GS A0A0L0JXZ0/122-217  OS Streptomyces europaeiscabiei
#=GS A0A0L0JXZ0/122-217  DE Transcriptional regulator
#=GS A0A0L0JXZ0/122-217  DR GENE3D; 2502f2a516f2ccd79e94ca1bd3113948/122-217; 
#=GS A0A0L0JXZ0/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces europaeiscabiei; 
#=GS A0A1A9DNB5/122-217  AC A0A1A9DNB5
#=GS A0A1A9DNB5/122-217  OS Streptomyces sp. MnatMP-M77
#=GS A0A1A9DNB5/122-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1A9DNB5/122-217  DR GENE3D; 2502f2a516f2ccd79e94ca1bd3113948/122-217; 
#=GS A0A1A9DNB5/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. MnatMP-M77; 
#=GS A0A0P6TU82/122-217  AC A0A0P6TU82
#=GS A0A0P6TU82/122-217  OS Streptomyces anulatus
#=GS A0A0P6TU82/122-217  DE Transcriptional regulator
#=GS A0A0P6TU82/122-217  DR GENE3D; 2502f2a516f2ccd79e94ca1bd3113948/122-217; 
#=GS A0A0P6TU82/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseus group; Streptomyces anulatus; 
#=GS A0A0Q7IXY0/122-217  AC A0A0Q7IXY0
#=GS A0A0Q7IXY0/122-217  OS Streptomyces sp. Root1295
#=GS A0A0Q7IXY0/122-217  DE Two-component system response regulator
#=GS A0A0Q7IXY0/122-217  DR GENE3D; 2502f2a516f2ccd79e94ca1bd3113948/122-217; 
#=GS A0A0Q7IXY0/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Root1295; 
#=GS H0BJ01/122-217      AC H0BJ01
#=GS H0BJ01/122-217      OS Streptomyces sp. W007
#=GS H0BJ01/122-217      DE Putative two-component system response regulator
#=GS H0BJ01/122-217      DR GENE3D; 2502f2a516f2ccd79e94ca1bd3113948/122-217; 
#=GS H0BJ01/122-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. W007; 
#=GS A0A0M4DJH1/122-217  AC A0A0M4DJH1
#=GS A0A0M4DJH1/122-217  OS Streptomyces sp. CFMR 7
#=GS A0A0M4DJH1/122-217  DE Transcriptional regulator
#=GS A0A0M4DJH1/122-217  DR GENE3D; 2502f2a516f2ccd79e94ca1bd3113948/122-217; 
#=GS A0A0M4DJH1/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CFMR 7; 
#=GS A0A1C6QGC5/122-217  AC A0A1C6QGC5
#=GS A0A1C6QGC5/122-217  OS Streptomyces
#=GS A0A1C6QGC5/122-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C6QGC5/122-217  DR GENE3D; 2502f2a516f2ccd79e94ca1bd3113948/122-217; 
#=GS A0A1C6QGC5/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; 
#=GS A0A0D7DDS3/122-217  AC A0A0D7DDS3
#=GS A0A0D7DDS3/122-217  OS Streptomyces sp. MNU77
#=GS A0A0D7DDS3/122-217  DE Transcriptional regulator
#=GS A0A0D7DDS3/122-217  DR GENE3D; 2502f2a516f2ccd79e94ca1bd3113948/122-217; 
#=GS A0A0D7DDS3/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. MNU77; 
#=GS A0A0C2AP42/124-217  AC A0A0C2AP42
#=GS A0A0C2AP42/124-217  OS Streptomyces sp. AcH 505
#=GS A0A0C2AP42/124-217  DE Transcriptional regulator
#=GS A0A0C2AP42/124-217  DR GENE3D; d4e7f2803317da56926f9a174c03fba9/124-217; 
#=GS A0A0C2AP42/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. AcH 505; 
#=GS M3CXS2/124-217      AC M3CXS2
#=GS M3CXS2/124-217      OS Streptomyces gancidicus BKS 13-15
#=GS M3CXS2/124-217      DE Two-component system response regulator
#=GS M3CXS2/124-217      DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS M3CXS2/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces gancidicus; 
#=GS H2K2C0/124-217      AC H2K2C0
#=GS H2K2C0/124-217      OS Streptomyces hygroscopicus subsp. jinggangensis 5008
#=GS H2K2C0/124-217      DE Two-component system response regulator
#=GS H2K2C0/124-217      DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS H2K2C0/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces hygroscopicus; Streptomyces hygroscopicus subsp. jinggangensis; 
#=GS A0A072S8P8/124-217  AC A0A072S8P8
#=GS A0A072S8P8/124-217  OS Streptomyces griseorubens
#=GS A0A072S8P8/124-217  DE Transcriptional regulator
#=GS A0A072S8P8/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A072S8P8/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseorubens; 
#=GS A0A117PUZ9/124-217  AC A0A117PUZ9
#=GS A0A117PUZ9/124-217  OS Streptomyces cellostaticus
#=GS A0A117PUZ9/124-217  DE Two-component system response regulator
#=GS A0A117PUZ9/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A117PUZ9/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces cellostaticus; 
#=GS A0A1K2FW94/124-217  AC A0A1K2FW94
#=GS A0A1K2FW94/124-217  OS Streptomyces sp. F-1
#=GS A0A1K2FW94/124-217  DE Transcriptional regulatory protein TcrA
#=GS A0A1K2FW94/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A1K2FW94/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. F-1; 
#=GS A0A0J8DEY6/124-217  AC A0A0J8DEY6
#=GS A0A0J8DEY6/124-217  OS Streptomyces regensis
#=GS A0A0J8DEY6/124-217  DE Transcriptional regulator
#=GS A0A0J8DEY6/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A0J8DEY6/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces regensis; 
#=GS A0A0X3XPV6/124-217  AC A0A0X3XPV6
#=GS A0A0X3XPV6/124-217  OS Streptomyces sp. NRRL WC-3605
#=GS A0A0X3XPV6/124-217  DE Two-component system response regulator
#=GS A0A0X3XPV6/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A0X3XPV6/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL WC-3605; 
#=GS A0A0L8NEU3/124-217  AC A0A0L8NEU3
#=GS A0A0L8NEU3/124-217  OS Streptomyces antibioticus
#=GS A0A0L8NEU3/124-217  DE Transcriptional regulator
#=GS A0A0L8NEU3/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A0L8NEU3/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces antibioticus; 
#=GS A0A086MWK0/124-217  AC A0A086MWK0
#=GS A0A086MWK0/124-217  OS Streptomyces luteus
#=GS A0A086MWK0/124-217  DE Transcriptional regulator
#=GS A0A086MWK0/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A086MWK0/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces luteus; 
#=GS A0A1C4SU15/124-217  AC A0A1C4SU15
#=GS A0A1C4SU15/124-217  OS Streptomyces sp. di188
#=GS A0A1C4SU15/124-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C4SU15/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A1C4SU15/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. di188; 
#=GS A0A1C4I6K9/124-217  AC A0A1C4I6K9
#=GS A0A1C4I6K9/124-217  OS Streptomyces sp. di50b
#=GS A0A1C4I6K9/124-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C4I6K9/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A1C4I6K9/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. di50b; 
#=GS A0A1M5WGZ6/124-217  AC A0A1M5WGZ6
#=GS A0A1M5WGZ6/124-217  OS Streptomyces sp. 3124.6
#=GS A0A1M5WGZ6/124-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1M5WGZ6/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A1M5WGZ6/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 3124.6; 
#=GS A0A101R1M9/124-217  AC A0A101R1M9
#=GS A0A101R1M9/124-217  OS Streptomyces longwoodensis
#=GS A0A101R1M9/124-217  DE Two-component system response regulator
#=GS A0A101R1M9/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A101R1M9/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces longwoodensis; 
#=GS A0A0U3QD64/124-217  AC A0A0U3QD64
#=GS A0A0U3QD64/124-217  OS Streptomyces sp. 4F
#=GS A0A0U3QD64/124-217  DE Two-component system response regulator
#=GS A0A0U3QD64/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A0U3QD64/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 4F; 
#=GS A0A0K8PLA1/124-217  AC A0A0K8PLA1
#=GS A0A0K8PLA1/124-217  OS Streptomyces azureus
#=GS A0A0K8PLA1/124-217  DE Two-component system response regulator
#=GS A0A0K8PLA1/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A0K8PLA1/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces azureus; 
#=GS A0A1B1ATW1/124-217  AC A0A1B1ATW1
#=GS A0A1B1ATW1/124-217  OS Streptomyces griseochromogenes
#=GS A0A1B1ATW1/124-217  DE DNA-binding response regulator
#=GS A0A1B1ATW1/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A1B1ATW1/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseochromogenes; 
#=GS A0A1J4NXS7/124-217  AC A0A1J4NXS7
#=GS A0A1J4NXS7/124-217  OS Streptomyces mangrovisoli
#=GS A0A1J4NXS7/124-217  DE DNA-binding response regulator
#=GS A0A1J4NXS7/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A1J4NXS7/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces mangrovisoli; 
#=GS A0A101Q202/124-217  AC A0A101Q202
#=GS A0A101Q202/124-217  OS Streptomyces corchorusii
#=GS A0A101Q202/124-217  DE Two-component system response regulator
#=GS A0A101Q202/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A101Q202/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces corchorusii; 
#=GS P0A4I2/124-217      AC P0A4I2
#=GS P0A4I2/124-217      OS Streptomyces lividans
#=GS P0A4I2/124-217      DE Transcriptional regulatory protein CutR
#=GS P0A4I2/124-217      DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS P0A4I2/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces lividans; 
#=GS A0A1J7BHC5/124-217  AC A0A1J7BHC5
#=GS A0A1J7BHC5/124-217  OS Streptomyces pluripotens
#=GS A0A1J7BHC5/124-217  DE DNA-binding response regulator
#=GS A0A1J7BHC5/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A1J7BHC5/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces pluripotens; 
#=GS A0A143C7J7/124-217  AC A0A143C7J7
#=GS A0A143C7J7/124-217  OS Streptomyces sp. S10(2016)
#=GS A0A143C7J7/124-217  DE DNA-binding response regulator
#=GS A0A143C7J7/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A143C7J7/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. S10(2016); 
#=GS A0A0K2B0E1/124-217  AC A0A0K2B0E1
#=GS A0A0K2B0E1/124-217  OS Streptomyces ambofaciens ATCC 23877
#=GS A0A0K2B0E1/124-217  DE Transcriptional regulatory protein CutR
#=GS A0A0K2B0E1/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A0K2B0E1/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces ambofaciens; 
#=GS A0A0S2P7K2/124-217  AC A0A0S2P7K2
#=GS A0A0S2P7K2/124-217  OS Streptomyces hygroscopicus subsp. limoneus
#=GS A0A0S2P7K2/124-217  DE Transcriptional regulatory protein CutR
#=GS A0A0S2P7K2/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A0S2P7K2/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces hygroscopicus; Streptomyces hygroscopicus subsp. limoneus; 
#=GS A0A066Y8S6/124-217  AC A0A066Y8S6
#=GS A0A066Y8S6/124-217  OS Streptomyces olindensis
#=GS A0A066Y8S6/124-217  DE Transcriptional regulator
#=GS A0A066Y8S6/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A066Y8S6/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces olindensis; 
#=GS A0A076M543/124-217  AC A0A076M543
#=GS A0A076M543/124-217  OS Streptomyces lividans TK24
#=GS A0A076M543/124-217  DE Transcriptional regulatory protein CutR
#=GS A0A076M543/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A076M543/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces lividans; 
#=GS A0A101SRF8/124-217  AC A0A101SRF8
#=GS A0A101SRF8/124-217  OS Streptomyces bungoensis
#=GS A0A101SRF8/124-217  DE Two-component system response regulator
#=GS A0A101SRF8/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A101SRF8/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces bungoensis; 
#=GS A0A176KV54/124-217  AC A0A176KV54
#=GS A0A176KV54/124-217  OS Streptomyces sp. FXJ1.172
#=GS A0A176KV54/124-217  DE DNA-binding response regulator
#=GS A0A176KV54/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A176KV54/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. FXJ1.172; 
#=GS A0A0N6ZHT0/124-217  AC A0A0N6ZHT0
#=GS A0A0N6ZHT0/124-217  OS Streptomyces sp. CCM_MD2014
#=GS A0A0N6ZHT0/124-217  DE Transcriptional regulator
#=GS A0A0N6ZHT0/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A0N6ZHT0/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CCM_MD2014; 
#=GS A0A1H2D2U4/124-217  AC A0A1H2D2U4
#=GS A0A1H2D2U4/124-217  OS Streptomyces sp. 2114.2
#=GS A0A1H2D2U4/124-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1H2D2U4/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A1H2D2U4/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 2114.2; 
#=GS A0A124I585/124-217  AC A0A124I585
#=GS A0A124I585/124-217  OS Streptomyces griseoruber
#=GS A0A124I585/124-217  DE Two-component system response regulator
#=GS A0A124I585/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A124I585/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseoruber; 
#=GS A0A151DMB4/124-217  AC A0A151DMB4
#=GS A0A151DMB4/124-217  OS Streptomyces sp. CC71
#=GS A0A151DMB4/124-217  DE Two-component system response regulator
#=GS A0A151DMB4/124-217  DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS A0A151DMB4/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CC71; 
#=GS D9WZ77/124-217      AC D9WZ77
#=GS D9WZ77/124-217      OS Streptomyces viridochromogenes DSM 40736
#=GS D9WZ77/124-217      DE Phosphate regulon transcriptional regulatory protein PhoB
#=GS D9WZ77/124-217      DR GENE3D; a7663d510c92e14f42e4b702e08637a5/124-217; 
#=GS D9WZ77/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces viridochromogenes; 
#=GS A0A0N0HSF4/124-217  AC A0A0N0HSF4
#=GS A0A0N0HSF4/124-217  OS Streptomyces sp. NRRL WC-3753
#=GS A0A0N0HSF4/124-217  DE Transcriptional regulator
#=GS A0A0N0HSF4/124-217  DR GENE3D; cf23e0955b24059ba7a10f04c1772a77/124-217; 
#=GS A0A0N0HSF4/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL WC-3753; 
#=GS A0A1C5ELV5/124-217  AC A0A1C5ELV5
#=GS A0A1C5ELV5/124-217  OS Streptomyces sp. LamerLS-31b
#=GS A0A1C5ELV5/124-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C5ELV5/124-217  DR GENE3D; cf23e0955b24059ba7a10f04c1772a77/124-217; 
#=GS A0A1C5ELV5/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. LamerLS-31b; 
#=GS A0A0Q9AUW2/124-217  AC A0A0Q9AUW2
#=GS A0A0Q9AUW2/124-217  OS Streptomyces sp. Root264
#=GS A0A0Q9AUW2/124-217  DE Two-component system response regulator
#=GS A0A0Q9AUW2/124-217  DR GENE3D; cf23e0955b24059ba7a10f04c1772a77/124-217; 
#=GS A0A0Q9AUW2/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Root264; 
#=GS A0A1C5BJ02/124-217  AC A0A1C5BJ02
#=GS A0A1C5BJ02/124-217  OS Streptomyces sp. DconLS
#=GS A0A1C5BJ02/124-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C5BJ02/124-217  DR GENE3D; cf23e0955b24059ba7a10f04c1772a77/124-217; 
#=GS A0A1C5BJ02/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. DconLS; 
#=GS A0A081XW39/124-217  AC A0A081XW39
#=GS A0A081XW39/124-217  OS Streptomyces toyocaensis
#=GS A0A081XW39/124-217  DE Transcriptional regulator
#=GS A0A081XW39/124-217  DR GENE3D; cf23e0955b24059ba7a10f04c1772a77/124-217; 
#=GS A0A081XW39/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces toyocaensis; 
#=GS A0A0U5LX16/124-217  AC A0A0U5LX16
#=GS A0A0U5LX16/124-217  OS Streptomyces reticuli
#=GS A0A0U5LX16/124-217  DE Transcriptional regulatory protein TcrA
#=GS A0A0U5LX16/124-217  DR GENE3D; cf23e0955b24059ba7a10f04c1772a77/124-217; 
#=GS A0A0U5LX16/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces reticuli; 
#=GS S5VAZ8/124-217      AC S5VAZ8
#=GS S5VAZ8/124-217      OS Streptomyces collinus Tu 365
#=GS S5VAZ8/124-217      DE Two-component system response regulator
#=GS S5VAZ8/124-217      DR GENE3D; cf23e0955b24059ba7a10f04c1772a77/124-217; 
#=GS S5VAZ8/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces collinus; 
#=GS H1Q6P9/124-217      AC H1Q6P9
#=GS H1Q6P9/124-217      OS Streptomyces coelicoflavus ZG0656
#=GS H1Q6P9/124-217      DE Two-component regulator CutR
#=GS H1Q6P9/124-217      DR GENE3D; cf23e0955b24059ba7a10f04c1772a77/124-217; 
#=GS H1Q6P9/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces coelicoflavus; 
#=GS A0A0H4C6E4/124-217  AC A0A0H4C6E4
#=GS A0A0H4C6E4/124-217  OS Streptomyces sp. PBH53
#=GS A0A0H4C6E4/124-217  DE Transcriptional regulator
#=GS A0A0H4C6E4/124-217  DR GENE3D; cf23e0955b24059ba7a10f04c1772a77/124-217; 
#=GS A0A0H4C6E4/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PBH53; 
#=GS Q82KJ8/124-217      AC Q82KJ8
#=GS Q82KJ8/124-217      OS Streptomyces avermitilis MA-4680 = NBRC 14893
#=GS Q82KJ8/124-217      DE Putative two-component system response regulator
#=GS Q82KJ8/124-217      DR GENE3D; b61c75907ff81aa24b48808c11ba012b/124-217; 
#=GS Q82KJ8/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces avermitilis; 
#=GS A0A117PPU9/124-217  AC A0A117PPU9
#=GS A0A117PPU9/124-217  OS Streptomyces pseudovenezuelae
#=GS A0A117PPU9/124-217  DE Two-component system response regulator
#=GS A0A117PPU9/124-217  DR GENE3D; b61c75907ff81aa24b48808c11ba012b/124-217; 
#=GS A0A117PPU9/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces pseudovenezuelae; 
#=GS A0A101R8U3/124-217  AC A0A101R8U3
#=GS A0A101R8U3/124-217  OS Streptomyces olivochromogenes
#=GS A0A101R8U3/124-217  DE Two-component system response regulator
#=GS A0A101R8U3/124-217  DR GENE3D; b61c75907ff81aa24b48808c11ba012b/124-217; 
#=GS A0A101R8U3/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces olivochromogenes; 
#=GS A0A1B2GPB5/124-217  AC A0A1B2GPB5
#=GS A0A1B2GPB5/124-217  OS Streptomyces noursei ATCC 11455
#=GS A0A1B2GPB5/124-217  DE Transcriptional regulatory protein CutR
#=GS A0A1B2GPB5/124-217  DR GENE3D; 7e2b82672f8dcbe4af43d4b8f10fed97/124-217; 
#=GS A0A1B2GPB5/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces noursei; 
#=GS A0A0A8EI62/124-217  AC A0A0A8EI62
#=GS A0A0A8EI62/124-217  OS Streptomyces sp. 769
#=GS A0A0A8EI62/124-217  DE Two-component regulator CutR
#=GS A0A0A8EI62/124-217  DR GENE3D; 7e2b82672f8dcbe4af43d4b8f10fed97/124-217; 
#=GS A0A0A8EI62/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 769; 
#=GS X0MZH6/124-217      AC X0MZH6
#=GS X0MZH6/124-217      OS Streptomyces albulus PD-1
#=GS X0MZH6/124-217      DE Transcriptional regulator
#=GS X0MZH6/124-217      DR GENE3D; 7e2b82672f8dcbe4af43d4b8f10fed97/124-217; 
#=GS X0MZH6/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albulus; 
#=GS A0A059W9C2/124-217  AC A0A059W9C2
#=GS A0A059W9C2/124-217  OS Streptomyces albulus
#=GS A0A059W9C2/124-217  DE Two-component system response regulator
#=GS A0A059W9C2/124-217  DR GENE3D; 7e2b82672f8dcbe4af43d4b8f10fed97/124-217; 
#=GS A0A059W9C2/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albulus; 
#=GS A0A1M7QGJ1/124-217  AC A0A1M7QGJ1
#=GS A0A1M7QGJ1/124-217  OS Streptomyces yunnanensis
#=GS A0A1M7QGJ1/124-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1M7QGJ1/124-217  DR GENE3D; 7e2b82672f8dcbe4af43d4b8f10fed97/124-217; 
#=GS A0A1M7QGJ1/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces yunnanensis; 
#=GS A0A0L8NKZ7/122-217  AC A0A0L8NKZ7
#=GS A0A0L8NKZ7/122-217  OS Streptomyces griseoflavus
#=GS A0A0L8NKZ7/122-217  DE Transcriptional regulator
#=GS A0A0L8NKZ7/122-217  DR GENE3D; 08ccaae6d8af00768e7d50dca3b771f6/122-217; 
#=GS A0A0L8NKZ7/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseoflavus; 
#=GS A0A0X3RED9/122-217  AC A0A0X3RED9
#=GS A0A0X3RED9/122-217  OS Streptomyces rimosus subsp. rimosus
#=GS A0A0X3RED9/122-217  DE Two-component system response regulator
#=GS A0A0X3RED9/122-217  DR GENE3D; 08ccaae6d8af00768e7d50dca3b771f6/122-217; 
#=GS A0A0X3RED9/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces rimosus; Streptomyces rimosus subsp. rimosus; 
#=GS A0A0X7JA77/122-217  AC A0A0X7JA77
#=GS A0A0X7JA77/122-217  OS Streptomyces albus subsp. albus
#=GS A0A0X7JA77/122-217  DE Two-component system response regulator
#=GS A0A0X7JA77/122-217  DR GENE3D; 08ccaae6d8af00768e7d50dca3b771f6/122-217; 
#=GS A0A0X7JA77/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus group; Streptomyces albus; Streptomyces albus subsp. albus; 
#=GS L8EQ26/122-217      AC L8EQ26
#=GS L8EQ26/122-217      OS Streptomyces rimosus subsp. rimosus ATCC 10970
#=GS L8EQ26/122-217      DE Winged helix family two component transcriptional regulator
#=GS L8EQ26/122-217      DR GENE3D; 08ccaae6d8af00768e7d50dca3b771f6/122-217; 
#=GS L8EQ26/122-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces rimosus; Streptomyces rimosus subsp. rimosus; 
#=GS A0A0L8P542/122-217  AC A0A0L8P542
#=GS A0A0L8P542/122-217  OS Streptomyces aureofaciens
#=GS A0A0L8P542/122-217  DE Transcriptional regulator
#=GS A0A0L8P542/122-217  DR GENE3D; 08ccaae6d8af00768e7d50dca3b771f6/122-217; 
#=GS A0A0L8P542/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces aureofaciens; 
#=GS D9UF66/124-217      AC D9UF66
#=GS D9UF66/124-217      OS Streptomyces sp. SPB78
#=GS D9UF66/124-217      DE Phosphate regulon transcriptional regulatory protein PhoB
#=GS D9UF66/124-217      DR GENE3D; 85720255252e56438e815ed365223440/124-217; 
#=GS D9UF66/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SPB78; 
#=GS A0A1C4JKV0/124-217  AC A0A1C4JKV0
#=GS A0A1C4JKV0/124-217  OS Streptomyces sp. TverLS-915
#=GS A0A1C4JKV0/124-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C4JKV0/124-217  DR GENE3D; 85720255252e56438e815ed365223440/124-217; 
#=GS A0A1C4JKV0/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. TverLS-915; 
#=GS A0A1C4VF16/124-217  AC A0A1C4VF16
#=GS A0A1C4VF16/124-217  OS Streptomyces sp. LcepLS
#=GS A0A1C4VF16/124-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C4VF16/124-217  DR GENE3D; 85720255252e56438e815ed365223440/124-217; 
#=GS A0A1C4VF16/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. LcepLS; 
#=GS A0A1C4TIL8/124-217  AC A0A1C4TIL8
#=GS A0A1C4TIL8/124-217  OS Streptomyces sp. DfronAA-171
#=GS A0A1C4TIL8/124-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C4TIL8/124-217  DR GENE3D; 85720255252e56438e815ed365223440/124-217; 
#=GS A0A1C4TIL8/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. DfronAA-171; 
#=GS A0A1C4QV21/124-217  AC A0A1C4QV21
#=GS A0A1C4QV21/124-217  OS Streptomyces sp. SolWspMP-sol7th
#=GS A0A1C4QV21/124-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C4QV21/124-217  DR GENE3D; 85720255252e56438e815ed365223440/124-217; 
#=GS A0A1C4QV21/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SolWspMP-sol7th; 
#=GS B5G720/124-217      AC B5G720
#=GS B5G720/124-217      OS Streptomyces sp. SPB074
#=GS B5G720/124-217      DE Transcriptional regulatory protein CutR
#=GS B5G720/124-217      DR GENE3D; 85720255252e56438e815ed365223440/124-217; 
#=GS B5G720/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SPB074; 
#=GS L7EYG7/124-217      AC L7EYG7
#=GS L7EYG7/124-217      OS Streptomyces turgidiscabies Car8
#=GS L7EYG7/124-217      DE Transcriptional regulatory protein CutR
#=GS L7EYG7/124-217      DR GENE3D; 233ef4949f09752b7a206196e8968bea/124-217; 
#=GS L7EYG7/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces turgidiscabies; 
#=GS B4V8P3/124-217      AC B4V8P3
#=GS B4V8P3/124-217      OS Streptomyces sp. Mg1
#=GS B4V8P3/124-217      DE Transcriptional regulator
#=GS B4V8P3/124-217      DR GENE3D; 62cb77bc1f370c886ba9e38ec1bb9d7e/124-217; 
#=GS B4V8P3/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Mg1; 
#=GS J2A1Z4/124-217      AC J2A1Z4
#=GS J2A1Z4/124-217      OS Streptomyces auratus AGR0001
#=GS J2A1Z4/124-217      DE Two-component regulator CutR
#=GS J2A1Z4/124-217      DR GENE3D; 0420ec861f7823d39d4e28401d268e21/124-217; 
#=GS J2A1Z4/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces auratus; 
#=GS A0A1C6N614/124-217  AC A0A1C6N614
#=GS A0A1C6N614/124-217  OS Streptomyces sp. SceaMP-e96
#=GS A0A1C6N614/124-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C6N614/124-217  DR GENE3D; 0420ec861f7823d39d4e28401d268e21/124-217; 
#=GS A0A1C6N614/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SceaMP-e96; 
#=GS A0A0L8LNK9/124-217  AC A0A0L8LNK9
#=GS A0A0L8LNK9/124-217  OS Streptomyces decoyicus
#=GS A0A0L8LNK9/124-217  DE Transcriptional regulator
#=GS A0A0L8LNK9/124-217  DR GENE3D; 0420ec861f7823d39d4e28401d268e21/124-217; 
#=GS A0A0L8LNK9/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces decoyicus; 
#=GS A0A0P4REP3/124-217  AC A0A0P4REP3
#=GS A0A0P4REP3/124-217  OS Streptomyces sp. NBRC 110027
#=GS A0A0P4REP3/124-217  DE Two-component response regulator
#=GS A0A0P4REP3/124-217  DR GENE3D; 0420ec861f7823d39d4e28401d268e21/124-217; 
#=GS A0A0P4REP3/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NBRC 110027; 
#=GS D6K3J5/124-217      AC D6K3J5
#=GS D6K3J5/124-217      OS Streptomyces sp. e14
#=GS D6K3J5/124-217      DE Transcriptional regulatory protein CutR
#=GS D6K3J5/124-217      DR GENE3D; cb1699de00fe9bb6ca12689638bd1c5d/124-217; 
#=GS D6K3J5/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. e14; 
#=GS A0A1C5EW39/122-217  AC A0A1C5EW39
#=GS A0A1C5EW39/122-217  OS Streptomyces sp. Ncost-T6T-2b
#=GS A0A1C5EW39/122-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C5EW39/122-217  DR GENE3D; 256bcf451834c223158636c497b5c297/122-217; 
#=GS A0A1C5EW39/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ncost-T6T-2b; 
#=GS A0A1C4NW57/122-217  AC A0A1C4NW57
#=GS A0A1C4NW57/122-217  OS Streptomyces sp. ScaeMP-e83
#=GS A0A1C4NW57/122-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C4NW57/122-217  DR GENE3D; 256bcf451834c223158636c497b5c297/122-217; 
#=GS A0A1C4NW57/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. ScaeMP-e83; 
#=GS A0A1A9D0R8/122-217  AC A0A1A9D0R8
#=GS A0A1A9D0R8/122-217  OS Streptomyces sp. Ncost-T6T-1
#=GS A0A1A9D0R8/122-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1A9D0R8/122-217  DR GENE3D; 256bcf451834c223158636c497b5c297/122-217; 
#=GS A0A1A9D0R8/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ncost-T6T-1; 
#=GS A0A1B9EW40/122-217  AC A0A1B9EW40
#=GS A0A1B9EW40/122-217  OS Streptomyces sp. PTY087I2
#=GS A0A1B9EW40/122-217  DE Transcriptional regulatory protein TcrA
#=GS A0A1B9EW40/122-217  DR GENE3D; 256bcf451834c223158636c497b5c297/122-217; 
#=GS A0A1B9EW40/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PTY087I2; 
#=GS A0A1C5DGN1/122-217  AC A0A1C5DGN1
#=GS A0A1C5DGN1/122-217  OS Streptomyces sp. Cmuel-A718b
#=GS A0A1C5DGN1/122-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C5DGN1/122-217  DR GENE3D; 256bcf451834c223158636c497b5c297/122-217; 
#=GS A0A1C5DGN1/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Cmuel-A718b; 
#=GS A0A1C6PU33/122-217  AC A0A1C6PU33
#=GS A0A1C6PU33/122-217  OS Streptomyces
#=GS A0A1C6PU33/122-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C6PU33/122-217  DR GENE3D; 256bcf451834c223158636c497b5c297/122-217; 
#=GS A0A1C6PU33/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; 
#=GS D6ATB4/122-217      AC D6ATB4
#=GS D6ATB4/122-217      OS Streptomyces roseosporus NRRL 15998
#=GS D6ATB4/122-217      DE Two-component system response regulator
#=GS D6ATB4/122-217      DR GENE3D; 256bcf451834c223158636c497b5c297/122-217; 
#=GS D6ATB4/122-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces filamentosus; 
#=GS A0A0D6VGW9/122-217  AC A0A0D6VGW9
#=GS A0A0D6VGW9/122-217  OS Streptomyces griseus
#=GS A0A0D6VGW9/122-217  DE Two-component system response regulator
#=GS A0A0D6VGW9/122-217  DR GENE3D; 256bcf451834c223158636c497b5c297/122-217; 
#=GS A0A0D6VGW9/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseus group; Streptomyces griseus; 
#=GS A0A1L6PF89/122-217  AC A0A1L6PF89
#=GS A0A1L6PF89/122-217  OS Streptomyces sp. Tue 6075
#=GS A0A1L6PF89/122-217  DE Transcriptional regulator
#=GS A0A1L6PF89/122-217  DR GENE3D; 256bcf451834c223158636c497b5c297/122-217; 
#=GS A0A1L6PF89/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Tue 6075; 
#=GS V6UHQ6/122-217      AC V6UHQ6
#=GS V6UHQ6/122-217      OS Streptomyces sp. HCCB10043
#=GS V6UHQ6/122-217      DE Putative two-component system response regulator
#=GS V6UHQ6/122-217      DR GENE3D; 256bcf451834c223158636c497b5c297/122-217; 
#=GS V6UHQ6/122-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. HCCB10043; 
#=GS W9FYT2/122-217      AC W9FYT2
#=GS W9FYT2/122-217      OS Streptomyces roseosporus NRRL 11379
#=GS W9FYT2/122-217      DE Phosphate regulon transcriptional regulatory protein PhoB
#=GS W9FYT2/122-217      DR GENE3D; 256bcf451834c223158636c497b5c297/122-217; 
#=GS W9FYT2/122-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces filamentosus; 
#=GS A0A1C4L469/122-217  AC A0A1C4L469
#=GS A0A1C4L469/122-217  OS Streptomyces sp. Termitarium-T10T-6
#=GS A0A1C4L469/122-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C4L469/122-217  DR GENE3D; 256bcf451834c223158636c497b5c297/122-217; 
#=GS A0A1C4L469/122-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Termitarium-T10T-6; 
#=GS N0CWY7/122-217      AC N0CWY7
#=GS N0CWY7/122-217      OS Streptomyces fulvissimus DSM 40593
#=GS N0CWY7/122-217      DE Uncharacterized protein
#=GS N0CWY7/122-217      DR GENE3D; 256bcf451834c223158636c497b5c297/122-217; 
#=GS N0CWY7/122-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces fulvissimus; 
#=GS A0A0L8MBA6/124-217  AC A0A0L8MBA6
#=GS A0A0L8MBA6/124-217  OS Streptomyces virginiae
#=GS A0A0L8MBA6/124-217  DE Transcriptional regulator
#=GS A0A0L8MBA6/124-217  DR GENE3D; abd73208f7278865f5eab0e6aa303e9f/124-217; 
#=GS A0A0L8MBA6/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces virginiae; 
#=GS A0A024YLW8/124-217  AC A0A024YLW8
#=GS A0A024YLW8/124-217  OS Streptomyces sp. PCS3-D2
#=GS A0A024YLW8/124-217  DE Transcriptional regulator
#=GS A0A024YLW8/124-217  DR GENE3D; abd73208f7278865f5eab0e6aa303e9f/124-217; 
#=GS A0A024YLW8/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PCS3-D2; 
#=GS A0A1E5PX24/124-217  AC A0A1E5PX24
#=GS A0A1E5PX24/124-217  OS Streptomyces subrutilus
#=GS A0A1E5PX24/124-217  DE DNA-binding response regulator
#=GS A0A1E5PX24/124-217  DR GENE3D; abd73208f7278865f5eab0e6aa303e9f/124-217; 
#=GS A0A1E5PX24/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces subrutilus; 
#=GS A0A0F4IN29/124-217  AC A0A0F4IN29
#=GS A0A0F4IN29/124-217  OS Streptomyces sp. NRRL S-104
#=GS A0A0F4IN29/124-217  DE Transcriptional regulator
#=GS A0A0F4IN29/124-217  DR GENE3D; abd73208f7278865f5eab0e6aa303e9f/124-217; 
#=GS A0A0F4IN29/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL S-104; 
#=GS D9XSI8/124-217      AC D9XSI8
#=GS D9XSI8/124-217      OS Streptomyces griseoflavus Tu4000
#=GS D9XSI8/124-217      DE Transcriptional regulatory protein CutR
#=GS D9XSI8/124-217      DR GENE3D; cb32c675504ed092b3b18c9056fb3611/124-217; 
#=GS D9XSI8/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseoflavus; 
#=GS V6KZM2/124-217      AC V6KZM2
#=GS V6KZM2/124-217      OS Streptomyces roseochromogenus subsp. oscitans DS 12.976
#=GS V6KZM2/124-217      DE Transcriptional regulator
#=GS V6KZM2/124-217      DR GENE3D; 41707c6ddcb5e499f8d68100f1d060c9/124-217; 
#=GS V6KZM2/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces roseochromogenus; Streptomyces roseochromogenus subsp. oscitans; 
#=GS A0A101NS44/124-217  AC A0A101NS44
#=GS A0A101NS44/124-217  OS Streptomyces yokosukanensis
#=GS A0A101NS44/124-217  DE Two-component system response regulator
#=GS A0A101NS44/124-217  DR GENE3D; 41707c6ddcb5e499f8d68100f1d060c9/124-217; 
#=GS A0A101NS44/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces yokosukanensis; 
#=GS E8W505/124-217      AC E8W505
#=GS E8W505/124-217      OS Streptomyces pratensis ATCC 33331
#=GS E8W505/124-217      DE Two component transcriptional regulator, winged helix family
#=GS E8W505/124-217      DR GENE3D; ff76674c3f32af8af493c8b12be12891/124-217; 
#=GS E8W505/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces pratensis; 
#=GS M9U3X9/124-217      AC M9U3X9
#=GS M9U3X9/124-217      OS Streptomyces sp. PAMC 26508
#=GS M9U3X9/124-217      DE Two-component system response regulator
#=GS M9U3X9/124-217      DR GENE3D; ff76674c3f32af8af493c8b12be12891/124-217; 
#=GS M9U3X9/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PAMC 26508; 
#=GS A0A0B5ER74/124-217  AC A0A0B5ER74
#=GS A0A0B5ER74/124-217  OS Streptomyces albus subsp. albus DSM 41398
#=GS A0A0B5ER74/124-217  DE Two-component regulator CutR
#=GS A0A0B5ER74/124-217  DR GENE3D; 8469aedc8da5175e16e873ca0a6d3377/124-217; 
#=GS A0A0B5ER74/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus group; Streptomyces albus; Streptomyces albus subsp. albus; 
#=GS A0A124C4B8/124-217  AC A0A124C4B8
#=GS A0A124C4B8/124-217  OS Streptomyces scabiei
#=GS A0A124C4B8/124-217  DE Transcriptional regulatory protein TcrA
#=GS A0A124C4B8/124-217  DR GENE3D; e0d5caf5020b6c275f756ee816c40905/124-217; 
#=GS A0A124C4B8/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces scabiei; 
#=GS C9Z0H0/124-217      AC C9Z0H0
#=GS C9Z0H0/124-217      OS Streptomyces scabiei 87.22
#=GS C9Z0H0/124-217      DE Two-component response regulator
#=GS C9Z0H0/124-217      DR GENE3D; e0d5caf5020b6c275f756ee816c40905/124-217; 
#=GS C9Z0H0/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces scabiei; 
#=GS A0A0B5DNQ9/124-217  AC A0A0B5DNQ9
#=GS A0A0B5DNQ9/124-217  OS Streptomyces nodosus
#=GS A0A0B5DNQ9/124-217  DE Transcriptional regulator
#=GS A0A0B5DNQ9/124-217  DR GENE3D; d397637504a8dc646c4d52b8baf02a65/124-217; 
#=GS A0A0B5DNQ9/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces nodosus; 
#=GS A0A0C1VT58/124-217  AC A0A0C1VT58
#=GS A0A0C1VT58/124-217  OS Streptomyces sp. RSD-27
#=GS A0A0C1VT58/124-217  DE Transcriptional regulator
#=GS A0A0C1VT58/124-217  DR GENE3D; ed67156ec3954624101c88cf5a1f7563/124-217; 
#=GS A0A0C1VT58/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. RSD-27; 
#=GS B5H8Q8/124-217      AC B5H8Q8
#=GS B5H8Q8/124-217      OS Streptomyces pristinaespiralis ATCC 25486
#=GS B5H8Q8/124-217      DE Two-component system response regulator CutR
#=GS B5H8Q8/124-217      DR GENE3D; 87c51438eaf9d74e0e5bbcfb64ecc213/124-217; 
#=GS B5H8Q8/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces pristinaespiralis; 
#=GS A0A0M4DPS3/124-217  AC A0A0M4DPS3
#=GS A0A0M4DPS3/124-217  OS Streptomyces pristinaespiralis
#=GS A0A0M4DPS3/124-217  DE Transcriptional regulator
#=GS A0A0M4DPS3/124-217  DR GENE3D; 87c51438eaf9d74e0e5bbcfb64ecc213/124-217; 
#=GS A0A0M4DPS3/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces pristinaespiralis; 
#=GS F8JVT3/124-217      AC F8JVT3
#=GS F8JVT3/124-217      OS Streptomyces cattleya NRRL 8057 = DSM 46488
#=GS F8JVT3/124-217      DE Two-component regulator CutR
#=GS F8JVT3/124-217      DR GENE3D; b88cfaf273fc20f02ce3ea080e9a90fa/124-217; 
#=GS F8JVT3/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces cattleya; 
#=GS A0A0N1FXR8/124-217  AC A0A0N1FXR8
#=GS A0A0N1FXR8/124-217  OS Actinobacteria bacterium OK074
#=GS A0A0N1FXR8/124-217  DE Two component transcriptional regulator, winged helix family
#=GS A0A0N1FXR8/124-217  DR GENE3D; 6195175224a5c97e83988200b417364d/124-217; 
#=GS A0A0N1FXR8/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Actinobacteria bacterium OK074; 
#=GS A0A101UVI7/124-217  AC A0A101UVI7
#=GS A0A101UVI7/124-217  OS Streptomyces sp. RV15
#=GS A0A101UVI7/124-217  DE Two-component system response regulator
#=GS A0A101UVI7/124-217  DR GENE3D; 6195175224a5c97e83988200b417364d/124-217; 
#=GS A0A101UVI7/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. RV15; 
#=GS A0A0L8LI49/124-217  AC A0A0L8LI49
#=GS A0A0L8LI49/124-217  OS Streptomyces resistomycificus
#=GS A0A0L8LI49/124-217  DE Transcriptional regulator
#=GS A0A0L8LI49/124-217  DR GENE3D; 6195175224a5c97e83988200b417364d/124-217; 
#=GS A0A0L8LI49/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces resistomycificus; 
#=GS A0A1B1MIR2/124-217  AC A0A1B1MIR2
#=GS A0A1B1MIR2/124-217  OS Streptomyces lincolnensis
#=GS A0A1B1MIR2/124-217  DE Two-component regulator
#=GS A0A1B1MIR2/124-217  DR GENE3D; 6195175224a5c97e83988200b417364d/124-217; 
#=GS A0A1B1MIR2/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces lincolnensis; 
#=GS K4R1G7/124-217      AC K4R1G7
#=GS K4R1G7/124-217      OS Streptomyces davawensis JCM 4913
#=GS K4R1G7/124-217      DE Transcriptional regulatory protein CutR
#=GS K4R1G7/124-217      DR GENE3D; 6195175224a5c97e83988200b417364d/124-217; 
#=GS K4R1G7/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces davawensis; 
#=GS A0A117Q9W5/124-217  AC A0A117Q9W5
#=GS A0A117Q9W5/124-217  OS Streptomyces antibioticus
#=GS A0A117Q9W5/124-217  DE Two-component system response regulator
#=GS A0A117Q9W5/124-217  DR GENE3D; 6195175224a5c97e83988200b417364d/124-217; 
#=GS A0A117Q9W5/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces antibioticus; 
#=GS A0A0X3UWZ1/124-217  AC A0A0X3UWZ1
#=GS A0A0X3UWZ1/124-217  OS Streptomyces regalis
#=GS A0A0X3UWZ1/124-217  DE Two-component system response regulator
#=GS A0A0X3UWZ1/124-217  DR GENE3D; 6195175224a5c97e83988200b417364d/124-217; 
#=GS A0A0X3UWZ1/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces regalis; 
#=GS B5I2G9/124-217      AC B5I2G9
#=GS B5I2G9/124-217      OS Streptomyces sviceus ATCC 29083
#=GS B5I2G9/124-217      DE Phosphate regulon transcriptional regulatory protein PhoB
#=GS B5I2G9/124-217      DR GENE3D; 6195175224a5c97e83988200b417364d/124-217; 
#=GS B5I2G9/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sviceus; 
#=GS A0A0J7ZJH9/124-217  AC A0A0J7ZJH9
#=GS A0A0J7ZJH9/124-217  OS Streptomyces viridochromogenes
#=GS A0A0J7ZJH9/124-217  DE Transcriptional regulator
#=GS A0A0J7ZJH9/124-217  DR GENE3D; 6195175224a5c97e83988200b417364d/124-217; 
#=GS A0A0J7ZJH9/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces viridochromogenes; 
#=GS A0A1A9BVI4/124-217  AC A0A1A9BVI4
#=GS A0A1A9BVI4/124-217  OS Streptomyces sp. DI166
#=GS A0A1A9BVI4/124-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1A9BVI4/124-217  DR GENE3D; 6195175224a5c97e83988200b417364d/124-217; 
#=GS A0A1A9BVI4/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. DI166; 
#=GS A0A101S2X0/124-217  AC A0A101S2X0
#=GS A0A101S2X0/124-217  OS Streptomyces griseorubiginosus
#=GS A0A101S2X0/124-217  DE Two-component system response regulator
#=GS A0A101S2X0/124-217  DR GENE3D; 6195175224a5c97e83988200b417364d/124-217; 
#=GS A0A101S2X0/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseorubiginosus; 
#=GS A0A117PG42/124-217  AC A0A117PG42
#=GS A0A117PG42/124-217  OS Streptomyces phaeopurpureus
#=GS A0A117PG42/124-217  DE Two-component system response regulator
#=GS A0A117PG42/124-217  DR GENE3D; 6195175224a5c97e83988200b417364d/124-217; 
#=GS A0A117PG42/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces phaeopurpureus; 
#=GS A0A101U3I2/124-217  AC A0A101U3I2
#=GS A0A101U3I2/124-217  OS Streptomyces caeruleatus
#=GS A0A101U3I2/124-217  DE Two-component system response regulator
#=GS A0A101U3I2/124-217  DR GENE3D; 6195175224a5c97e83988200b417364d/124-217; 
#=GS A0A101U3I2/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces caeruleatus; 
#=GS D6BB49/124-217      AC D6BB49
#=GS D6BB49/124-217      OS Streptomyces albus J1074
#=GS D6BB49/124-217      DE Two-component system response regulator
#=GS D6BB49/124-217      DR GENE3D; ca766fc27c3c8f48890d191d4bc68b31/124-217; 
#=GS D6BB49/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus group; Streptomyces albus; 
#=GS V4J2Q8/124-217      AC V4J2Q8
#=GS V4J2Q8/124-217      OS Streptomyces sp. PVA 94-07
#=GS V4J2Q8/124-217      DE Two-component response regulator CutR
#=GS V4J2Q8/124-217      DR GENE3D; ca766fc27c3c8f48890d191d4bc68b31/124-217; 
#=GS V4J2Q8/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PVA 94-07; 
#=GS A0A0X3WHP1/124-217  AC A0A0X3WHP1
#=GS A0A0X3WHP1/124-217  OS Streptomyces griseus subsp. griseus
#=GS A0A0X3WHP1/124-217  DE Two-component system response regulator
#=GS A0A0X3WHP1/124-217  DR GENE3D; ca766fc27c3c8f48890d191d4bc68b31/124-217; 
#=GS A0A0X3WHP1/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseus group; Streptomyces griseus; Streptomyces griseus subsp. griseus; 
#=GS G2NR06/123-217      AC G2NR06
#=GS G2NR06/123-217      OS Streptomyces sp. SirexAA-E
#=GS G2NR06/123-217      DE Two component transcriptional regulator, winged helix family
#=GS G2NR06/123-217      DR GENE3D; 67c0ca11922dffc85efb464d4d957f3b/123-217; 
#=GS G2NR06/123-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SirexAA-E; 
#=GS A0A1C4JKB8/123-217  AC A0A1C4JKB8
#=GS A0A1C4JKB8/123-217  OS Streptomyces sp. BpilaLS-43
#=GS A0A1C4JKB8/123-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C4JKB8/123-217  DR GENE3D; 67c0ca11922dffc85efb464d4d957f3b/123-217; 
#=GS A0A1C4JKB8/123-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. BpilaLS-43; 
#=GS A0A1C6WVH0/123-217  AC A0A1C6WVH0
#=GS A0A1C6WVH0/123-217  OS Streptomyces sp. DpondAA-F4
#=GS A0A1C6WVH0/123-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C6WVH0/123-217  DR GENE3D; 67c0ca11922dffc85efb464d4d957f3b/123-217; 
#=GS A0A1C6WVH0/123-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. DpondAA-F4; 
#=GS A0A1C4M7J1/123-217  AC A0A1C4M7J1
#=GS A0A1C4M7J1/123-217  OS Streptomyces sp. DpondAA-F4a
#=GS A0A1C4M7J1/123-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C4M7J1/123-217  DR GENE3D; 67c0ca11922dffc85efb464d4d957f3b/123-217; 
#=GS A0A1C4M7J1/123-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. DpondAA-F4a; 
#=GS F3NNV8/124-217      AC F3NNV8
#=GS F3NNV8/124-217      OS Streptomyces griseoaurantiacus M045
#=GS F3NNV8/124-217      DE Two-component regulator CutR
#=GS F3NNV8/124-217      DR GENE3D; f009342f13466c672344fbf61c9ec095/124-217; 
#=GS F3NNV8/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseoaurantiacus; 
#=GS D5ZRW7/124-217      AC D5ZRW7
#=GS D5ZRW7/124-217      OS Streptomyces ghanaensis ATCC 14672
#=GS D5ZRW7/124-217      DE Two-component regulator CutR
#=GS D5ZRW7/124-217      DR GENE3D; f009342f13466c672344fbf61c9ec095/124-217; 
#=GS D5ZRW7/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces ghanaensis; 
#=GS S2YMD3/124-217      AC S2YMD3
#=GS S2YMD3/124-217      OS Streptomyces sp. HGB0020
#=GS S2YMD3/124-217      DE Transcriptional regulatory protein CutR
#=GS S2YMD3/124-217      DR GENE3D; be0e7200ff0b64c89aeaaa073ab785cf/124-217; 
#=GS S2YMD3/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. HGB0020; 
#=GS A0A1A9J249/124-217  AC A0A1A9J249
#=GS A0A1A9J249/124-217  OS Streptomyces sp. SAT1
#=GS A0A1A9J249/124-217  DE DNA-binding response regulator
#=GS A0A1A9J249/124-217  DR GENE3D; 88a66a048684c5e6865d5c790f19a9e7/124-217; 
#=GS A0A1A9J249/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SAT1; 
#=GS A0A022MPP0/124-217  AC A0A022MPP0
#=GS A0A022MPP0/124-217  OS Streptomyces sp. Tu 6176
#=GS A0A022MPP0/124-217  DE Transcriptional regulator
#=GS A0A022MPP0/124-217  DR GENE3D; 88a66a048684c5e6865d5c790f19a9e7/124-217; 
#=GS A0A022MPP0/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Tu 6176; 
#=GS B5GUQ3/124-217      AC B5GUQ3
#=GS B5GUQ3/124-217      OS Streptomyces clavuligerus ATCC 27064
#=GS B5GUQ3/124-217      DE Transcriptional regulatory protein cutR
#=GS B5GUQ3/124-217      DR GENE3D; 69f02b8073e4793164c9bdfb7aad952a/124-217; 
#=GS B5GUQ3/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces clavuligerus; 
#=GS M3C390/124-217      AC M3C390
#=GS M3C390/124-217      OS Streptomyces mobaraensis NBRC 13819 = DSM 40847
#=GS M3C390/124-217      DE Two-component regulator CutR
#=GS M3C390/124-217      DR GENE3D; 22fab22849d8fc176fc1f20cb36b7960/124-217; 
#=GS M3C390/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces mobaraensis; 
#=GS A0A117PC96/124-217  AC A0A117PC96
#=GS A0A117PC96/124-217  OS Streptomyces curacoi
#=GS A0A117PC96/124-217  DE Two-component system response regulator
#=GS A0A117PC96/124-217  DR GENE3D; 6d0135aacdd9c90760f537b5b43c3e50/124-217; 
#=GS A0A117PC96/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces curacoi; 
#=GS L8PLF3/124-217      AC L8PLF3
#=GS L8PLF3/124-217      OS Streptomyces viridochromogenes Tue57
#=GS L8PLF3/124-217      DE Putative Phosphate regulon transcriptional regulatory protein PhoB
#=GS L8PLF3/124-217      DR GENE3D; 6d0135aacdd9c90760f537b5b43c3e50/124-217; 
#=GS L8PLF3/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces viridochromogenes; 
#=GS S3ZRE3/124-217      AC S3ZRE3
#=GS S3ZRE3/124-217      OS Streptomyces aurantiacus JA 4570
#=GS S3ZRE3/124-217      DE Putative transcriptional regulatory protein CutR
#=GS S3ZRE3/124-217      DR GENE3D; 8b6d32f4056505ae4d778e7819b7d09f/124-217; 
#=GS S3ZRE3/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces aurantiacus; 
#=GS F2R813/127-220      AC F2R813
#=GS F2R813/127-220      OS Streptomyces venezuelae ATCC 10712
#=GS F2R813/127-220      DE Two-component regulator CutR
#=GS F2R813/127-220      DR GENE3D; 323b6f03087dff3d250c87e5f18fb02e/127-220; 
#=GS F2R813/127-220      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces venezuelae; 
#=GS I2N889/124-217      AC I2N889
#=GS I2N889/124-217      OS Streptomyces tsukubensis NRRL18488
#=GS I2N889/124-217      DE Two-component system response regulator
#=GS I2N889/124-217      DR GENE3D; 0529d4779006ff8145917887ef1947ea/124-217; 
#=GS I2N889/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces tsukubensis; 
#=GS A0A089XGF6/124-217  AC A0A089XGF6
#=GS A0A089XGF6/124-217  OS Streptomyces glaucescens
#=GS A0A089XGF6/124-217  DE Transcriptional regulatory protein CutR
#=GS A0A089XGF6/124-217  DR GENE3D; 4e54883d8e2e231b1187c531c7143878/124-217; 
#=GS A0A089XGF6/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces glaucescens; 
#=GS L1KJA0/124-217      AC L1KJA0
#=GS L1KJA0/124-217      OS Streptomyces ipomoeae 91-03
#=GS L1KJA0/124-217      DE Transcriptional regulatory protein CutR
#=GS L1KJA0/124-217      DR GENE3D; a2467ee55e7a972a745bb44df1db498c/124-217; 
#=GS L1KJA0/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces ipomoeae; 
#=GS S4NSE8/124-217      AC S4NSE8
#=GS S4NSE8/124-217      OS Streptomyces afghaniensis 772
#=GS S4NSE8/124-217      DE Putative transcriptional regulatory protein CutR
#=GS S4NSE8/124-217      DR GENE3D; 13ff6f118ef5cbaa9cf7a8246fd5ec7f/124-217; 
#=GS S4NSE8/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces afghaniensis; 
#=GS D9W1S8/124-217      AC D9W1S8
#=GS D9W1S8/124-217      OS Streptomyces sp. C
#=GS D9W1S8/124-217      DE Phosphate regulon transcriptional regulatory protein PhoB
#=GS D9W1S8/124-217      DR GENE3D; c9d2cf3fa1bd2270b1f6949226e971aa/124-217; 
#=GS D9W1S8/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. C; 
#=GS A0A0C1Y938/124-217  AC A0A0C1Y938
#=GS A0A0C1Y938/124-217  OS Streptomyces sp. 150FB
#=GS A0A0C1Y938/124-217  DE Transcriptional regulator
#=GS A0A0C1Y938/124-217  DR GENE3D; d796dcaa8aea5d276217aa015a902dc6/124-217; 
#=GS A0A0C1Y938/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 150FB; 
#=GS G2GJS6/124-217      AC G2GJS6
#=GS G2GJS6/124-217      OS Streptomyces zinciresistens K42
#=GS G2GJS6/124-217      DE Two-component system response regulator
#=GS G2GJS6/124-217      DR GENE3D; f1f559eb179d3ea9bc4a90d5d1a7688e/124-217; 
#=GS G2GJS6/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces zinciresistens; 
#=GF TC 204.4 4.0E-64
#=GF SQ 160
P0A4I1/124-217              --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0X3T389/122-217          ALPPVLERAGIKLDPNRREVFRDGREIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1C5FV05/122-217          ALPPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
G2P2D5/122-217              ALPPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A0X3XG62/122-217          ALPPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A014MN82/122-217          ALPPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A0F4KCM1/122-217          ALPPVLERAGIKLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
D9W9Q4/122-217              ALPPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A0L8QT93/122-217          ALPPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
D7C8K0/122-217              ALPPVLERAGIKLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
V6KFA8/124-217              --PPVLERSGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
B1VXN3/122-217              ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
G0PYW2/122-217              ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1C4RS67/122-217          ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0Q8EMD3/122-217          ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1C4RZK7/122-217          ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0L0JXZ0/122-217          ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1A9DNB5/122-217          ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0P6TU82/122-217          ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0Q7IXY0/122-217          ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
H0BJ01/122-217              ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0M4DJH1/122-217          ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1C6QGC5/122-217          ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0D7DDS3/122-217          ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0C2AP42/124-217          --PPVLERSGIKLDPNRREVFRDGKEIQLAPKEFAVLDVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
M3CXS2/124-217              --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
H2K2C0/124-217              --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A072S8P8/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A117PUZ9/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1K2FW94/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0J8DEY6/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0X3XPV6/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0L8NEU3/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A086MWK0/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1C4SU15/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1C4I6K9/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1M5WGZ6/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A101R1M9/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0U3QD64/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0K8PLA1/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1B1ATW1/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1J4NXS7/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A101Q202/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
P0A4I2/124-217              --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1J7BHC5/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A143C7J7/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0K2B0E1/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0S2P7K2/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A066Y8S6/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A076M543/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A101SRF8/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A176KV54/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0N6ZHT0/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1H2D2U4/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A124I585/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A151DMB4/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
D9WZ77/124-217              --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0N0HSF4/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1C5ELV5/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0Q9AUW2/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1C5BJ02/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A081XW39/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0U5LX16/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
S5VAZ8/124-217              --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
H1Q6P9/124-217              --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0H4C6E4/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
Q82KJ8/124-217              --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A117PPU9/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A101R8U3/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1B2GPB5/124-217          --PPVLERAGIKLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A0A8EI62/124-217          --PPVLERAGIKLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
X0MZH6/124-217              --PPVLERAGIKLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A059W9C2/124-217          --PPVLERAGIKLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A1M7QGJ1/124-217          --PPVLERAGIKLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A0L8NKZ7/122-217          ALPPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A0X3RED9/122-217          ALPPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A0X7JA77/122-217          ALPPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
L8EQ26/122-217              ALPPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A0L8P542/122-217          ALPPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
D9UF66/124-217              --PPVLERAGIKLDPNRREIFRDGREIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A1C4JKV0/124-217          --PPVLERAGIKLDPNRREIFRDGREIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A1C4VF16/124-217          --PPVLERAGIKLDPNRREIFRDGREIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A1C4TIL8/124-217          --PPVLERAGIKLDPNRREIFRDGREIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A1C4QV21/124-217          --PPVLERAGIKLDPNRREIFRDGREIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
B5G720/124-217              --PPVLERAGIKLDPNRREIFRDGREIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
L7EYG7/124-217              --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
B4V8P3/124-217              --PPVLERAGIKLDPNRREVFREGKEVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
J2A1Z4/124-217              --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A1C6N614/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A0L8LNK9/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A0P4REP3/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
D6K3J5/124-217              --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1C5EW39/122-217          ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1C4NW57/122-217          ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1A9D0R8/122-217          ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1B9EW40/122-217          ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1C5DGN1/122-217          ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1C6PU33/122-217          ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
D6ATB4/122-217              ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0D6VGW9/122-217          ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1L6PF89/122-217          ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
V6UHQ6/122-217              ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
W9FYT2/122-217              ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1C4L469/122-217          ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
N0CWY7/122-217              ALPPVLERAGIKLDPNRREVFRDEVEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0L8MBA6/124-217          --PPVLERAGIKLDPNRREVFREGKEVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A024YLW8/124-217          --PPVLERAGIKLDPNRREVFREGKEVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1E5PX24/124-217          --PPVLERAGIKLDPNRREVFREGKEVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0F4IN29/124-217          --PPVLERAGIKLDPNRREVFREGKEVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
D9XSI8/124-217              --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
V6KZM2/124-217              --PPVLERAGIKLDPNRREVFREGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A101NS44/124-217          --PPVLERAGIKLDPNRREVFREGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
E8W505/124-217              --PPVLERAGIKLDPNRREVFRDEQEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
M9U3X9/124-217              --PPVLERAGIKLDPNRREVFRDEQEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0B5ER74/124-217          --PPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A124C4B8/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
C9Z0H0/124-217              --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0B5DNQ9/124-217          --PPVLERAGIKLDPNRREVFREGREVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A0C1VT58/124-217          --PPVLERAGIKLDPNRREVFREGREVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
B5H8Q8/124-217              --PPVLERAGIKLDPNRREVFRDGREIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0M4DPS3/124-217          --PPVLERAGIKLDPNRREVFRDGREIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
F8JVT3/124-217              --PPVLERAGIKLDPNRREVFRDGREVHLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0N1FXR8/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A101UVI7/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0L8LI49/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1B1MIR2/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
K4R1G7/124-217              --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A117Q9W5/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0X3UWZ1/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
B5I2G9/124-217              --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0J7ZJH9/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1A9BVI4/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A101S2X0/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A117PG42/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A101U3I2/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
D6BB49/124-217              --PPVLERAGIKLDPNRREVFRDGREIQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
V4J2Q8/124-217              --PPVLERAGIKLDPNRREVFRDGREIQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
A0A0X3WHP1/124-217          --PPVLERAGIKLDPNRREVFRDGREIQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
G2NR06/123-217              -LPPVLERAGIRLDPNRREVFRGDQEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1C4JKB8/123-217          -LPPVLERAGIRLDPNRREVFRGDQEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1C6WVH0/123-217          -LPPVLERAGIRLDPNRREVFRGDQEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1C4M7J1/123-217          -LPPVLERAGIRLDPNRREVFRGDQEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
F3NNV8/124-217              --PPVLERAGIKLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
D5ZRW7/124-217              --PPVLERAGIKLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
S2YMD3/124-217              --PPVLERSGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A1A9J249/124-217          --PPVLERAGIKLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A022MPP0/124-217          --PPVLERAGIKLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
B5GUQ3/124-217              --PPVLERAGIKLDPNRREIFRDGREIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
M3C390/124-217              --PPVLERAGIRLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A117PC96/124-217          --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
L8PLF3/124-217              --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
S3ZRE3/124-217              --PPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
F2R813/127-220              --PPVLERAGIKLDPNRREVFREGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
I2N889/124-217              --PPVLERAGIKLDPNRREVFRDGREIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A089XGF6/124-217          --PPVLERAGIKLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
L1KJA0/124-217              --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
S4NSE8/124-217              --PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
D9W1S8/124-217              --PPVLERAGIKLDPNRREVFREGREVQLAPKEFAVLEVLMRSEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
A0A0C1Y938/124-217          --PPVLERSGIKLDPNRREVFRDGREIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI
G2GJS6/124-217              --PPVLERAGIKLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI
#=GC scorecons              119999998998999999989986497899999999989989999799999999999999999999999999999999999996999999999999
#=GC scorecons_70           __**********************_***********************************************************************
#=GC scorecons_80           __*********************__**********************************************************_************
#=GC scorecons_90           __*********************__*_******************_*************************************_************
//